HORDB

ID: hor006995
Uniprot ID: P27104
Protein name: Natriuretic peptides A
Gene name: PTHLH
Organism: Equus caballus
Family: Natriuretic peptide family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse)
GO MF: GO:0042995 cell projection; GO:0005737 cytoplasm; GO:0005615 extracellular space; GO:0043204 perikaryon
GO BP: GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO CC: GO:0006182 cGMP biosynthetic process; GO:0019934 cGMP-mediated signaling; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0007218 neuropeptide signaling pathway; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0008217 regulation of blood pressure; GO:0042311 vasodilation; GO:0007565 female pregnancy

Sequence: PVYGSVSNGDLMDFKNLLDRLEDKMPLEDEVMPPQVLSDQSEEERAALSPLPEVPPWTGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Length: 125
Propeptide: MGSFSTIMASFLLFLAFQLQGQTRANPVYGSVSNGDLMDFKNLLDRLEDKMPLEDEVMPPQVLSDQSEEERAALSPLPEVPPWTGEVNPAQRDGGALGRGSWDSSDRSALLKSKLRALLAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
Signal peptide: MGSFSTIMASFLLFLAFQLQGQTRA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: